General Information

  • ID:  hor002671
  • Uniprot ID:  Q9N4D8
  • Protein name:  NLP-40
  • Gene name:  nlp-40
  • Organism:  Caenorhabditis elegans
  • Family:  NA
  • Source:  Animal
  • Expression:  Expressed in intestinal cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:2000294 positive regulation of defecation
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0031410 cytoplasmic vesicle

Sequence Information

  • Sequence:  APSAPAGLEEKLR
  • Length:  13(18-30)
  • Propeptide:  MKLVILLSFVATVAVFAAPSAPAGLEEKLRALQEQLYSLEKENGVDVKQKEQPAAADTFLGFVPQKRMVAWQPMKRSMINEDSRAPLLHAIEARLAEVLRAGERLGVNPEEVLADLRARNQFQ
  • Signal peptide:  MKLVILLSFVATVAVFA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Peptide P3]: Neuropeptide ligand for the G-protein coupled receptor aex-2. Activates and regulates the rhythmic calcium influx in DVB GABergic neurons during the defecation motor program, which is a coordinated series of three muscle contractions that oc
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9N4D8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002671_AF2.pdbhor002671_ESM.pdb

Physical Information

Mass: 155275 Formula: C58H99N17O19
Absent amino acids: CDFHIMNQTVWY Common amino acids: A
pI: 6.53 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 5
Hydrophobicity: -52.31 Boman Index: -2128
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 83.08
Instability Index: 10185.38 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18760316
  • Title:  Comparative Peptidomics of Caenorhabditis Elegans Versus C. Briggsae by LC-MALDI-TOF MS